SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5E9G4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5E9G4
Domain Number 1 Region: 148-238
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-20
Family B3 DNA binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5E9G4
Sequence length 249
Comment (tr|A0A2G5E9G4|A0A2G5E9G4_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA52398.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_01000340v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MAISTYTPKEEIEAPKRKGPRELVNDRATKYIRQERCTRFGLQLNKMDEGDHLDSDCSNN
HSTLPNVTSPIGDNPHQRKNPEDPQELPSSILYSGVQSNVSKTRTSKSAAISGRVKKAPG
RKPLESMPSRDAAAQEKERNIATAASTSNKPFCSVTMRATYVGSKSHTLVLPSPFAKKYM
KRAPRNVTLRVINGGTWHALYKIGAHHKLVRGWNAFVLDNHLKEDDVCNFELVDGNRNHY
ELKVSIDRS
Download sequence
Identical sequences A0A2G5E9G4
Aquca_010_00340.1|PACid:22046572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]