SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5E9T3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5E9T3
Domain Number 1 Region: 105-277
Classification Level Classification E-value
Superfamily L domain-like 0.000000544
Family Ngr ectodomain-like 0.04
Further Details:      
 
Domain Number 2 Region: 7-53
Classification Level Classification E-value
Superfamily F-box domain 0.0000144
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5E9T3
Sequence length 405
Comment (tr|A0A2G5E9T3|A0A2G5E9T3_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA52461.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_01000380v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MASDNLDRLSNSPKEVIDAILARMPVRDAVKTSFLSKGWRYRWMSMPVLVIKRERGSGYP
IAFVNKLLLLHEGIVSKFELDDFLKTSSDVNHWILVLSRKTVNDLKLNFQPNDNYQVPSC
LFCCQSLRKLELGGCLLKLPSDYRGFCGLTQLILSYVTLTNETFHSLLLKIPLLQTLLIN
YCKSLTHFNIHALNLKEFTVEGDCESFNFQNAPNVKVAKIKVSLPGFPVRFKLDDDLQGL
DRVESLTLFNPFVEFLPTDIAQERLDITYSHLTDVCLHVNFEDVKQILAVLCLCRSAPRL
ETFKINAIWDRKSALSYEENFWEVGLHKEDAVFDHLKTVSLSHFKGVKNDMGFVQFILLK
AGGLKTFCINWEVNAAMDVKKHVLEKMMEFQRASTICKVVFKNKA
Download sequence
Identical sequences A0A2G5E9T3
Aquca_010_00380.1|PACid:22046947 Aquca_010_00380.2|PACid:22046946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]