SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5E9U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5E9U5
Domain Number 1 Region: 50-111
Classification Level Classification E-value
Superfamily Homeodomain-like 7.1e-16
Family Homeodomain 0.008
Further Details:      
 
Weak hits

Sequence:  A0A2G5E9U5
Domain Number - Region: 103-150
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5E9U5
Sequence length 204
Comment (tr|A0A2G5E9U5|A0A2G5E9U5_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA52538.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_01000425v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MNQENAHLFFNIQDHTSSLYTYATSAEGETKKKKRQRRKKDKNEGGADARKRKLSAAQVN
GLETYFSIDHNLETQRKERIASELGLDPQQVAIWFQNRRVRWRVKKLEDEYYKLKATHEN
VIVEKSQLESQVLRLKAQLSDAQNEMTRLVERSDGVSSNSQSSSFSMDMDPFFLGDFGME
GLEKVFYFNNSVNGMEWVNNVYDM
Download sequence
Identical sequences A0A2G5E9U5
Aquca_010_00425.1|PACid:22047059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]