SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5EAU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5EAU2
Domain Number 1 Region: 8-101
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000439
Family WD40-repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5EAU2
Sequence length 123
Comment (tr|A0A2G5EAU2|A0A2G5EAU2_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA52888.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_01000629v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MPTEGPKYIVVAGEQSSEVEIWDLNSAERIARVPQICYGDTSNHCTKARGMCMAVQAFLP
SQSQGFLNLLAGYEDGSIAWWDIRSLGVPLTTAKFHSEPGSQFIIMSLYFISFVIYQMKI
VFV
Download sequence
Identical sequences A0A2G5EAU2
Aquca_010_00629.1|PACid:22047258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]