SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5ECG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5ECG6
Domain Number 1 Region: 223-536
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.24e-32
Family WD40-repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  A0A2G5ECG6
Domain Number - Region: 18-73
Classification Level Classification E-value
Superfamily Tropomyosin 0.0124
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5ECG6
Sequence length 539
Comment (tr|A0A2G5ECG6|A0A2G5ECG6_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA53401.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_00900168v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MDRILKKPKLEEESNGIKEEYEEQEEALVALIEHRTKEVDHVKQKISYYKSQLEQAERRL
NDSQSKLARLRSRDSLTGSRKAIVDCNRNVKEEPKSSSPVCIEESNSGSQSNSRPQIIIP
AVKPKIAEPVKLAESSTKASVGSGSRVGALVSTQSNGVRKVKEEVSCKPSDELEVVEVQA
KRTKRKFEQKEHKELIPLIRSYSSPSMVHCQPGVHISSQHKRKLRSLVLCPSDDQLFVTS
ALDGIVNLWQVHSKGSGASLLSSTDCVSTKQRRWPEDITWHPHGGSLFCVYTADAGDSQL
SILDLNSSQRGKRVTYSEEKPHVKGIINNIVFMPWADLCFVTGGSDHAVVIWKEKDGENS
WKHKSLHRNLHSSAVMGVAGLQQKNIVLSAGADKRIIGFDVMAGRADFKHQIECKCMSVL
PNPSDFNLFMVQTGAHERQLRLFDIRLRQTEIHAFGWKQESSESQSALINQAWSPDGLYI
TSGSADPIIHIFDIRYNSHRPSQSVKAHQKRVFKAVWLNSLPLLVSISSDLNIGLHKVS
Download sequence
Identical sequences A0A2G5ECG6
Aquca_009_00168.1|PACid:22034183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]