SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5EGR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5EGR0
Domain Number 1 Region: 353-449
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.03e-18
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5EGR0
Sequence length 902
Comment (tr|A0A2G5EGR0|A0A2G5EGR0_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA54964.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_00800005v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MSSLITKRSSFCYNLNCKGDAAAAPPEGQQKLIKRAWRLHNGDFAHLCLPCSAVFEEGKF
CETFHLDAAGWRSCDSCEKRVHCGCIVSINSYLLLDAGGVECMPCAWKNIIMAPNQIWPS
SSSLSHSNRQNNLSVKNWNQSAGPCAISGHRQQQLNMLNTSAVLSDLNPTMQYDVDGLRK
ISRDYSAPDLEKKSLGDPSDKVNNCNLFMMDSLTNGNGVVDMLAASHSLRWNEMSLNSLQ
GIAYRASLQSSSSKEDPSIPAIARVPYSLRNEANVPEDVSLTQSRHQTISTPMANQSNVN
IQTGAKSCGESPVRKGRHPVDTRGRSQLLPRYSPKIIDPELQKISEASNSVITPLFEKML
SASDAGRIGRLVLPKRCAEAYFPAISQSEGIPLKVQDAKGQEWVLHFRFWPNNNSRMYVL
EGVTPCIQSMQLQAGDTVTFSRIDPGGKLAIGCRKAVRISPSDQDKLSLKTVGDVSKISE
VNEADPAGSWPENGKSGYASKDRAGSKSRPRKRRGSSLGFKSKRLSIDNEDLIELKLTWE
EAQGLLRPPPDYVPNVMVIDGHEFEEYEEAPLLGKPTICGTDQVGEMFQWAQCEDCSKWR
KVPINANLPFGWTCSANLWDPKRSSCSSAQEAKPKQLEDVVSSRKTASASKKTKPVRKHM
DADKVSEGLNTPVEHSPILEDDALPSVKTTTRHPRHRFGCTCIVCIQSPSGKGLKHKDSC
TCNVCLTVRRRRLSLLKHFSEKDMESARQKLEQLKLPENPTMKDDVQKVVYSDGADSNPK
LMADENSNDFPRENPSSPIGQIDLNILLEREDGPSSISGSGNMVRLQSGTHKLYPVLHGS
TGLSGDVDLALNERLPGEGRCNGNGARGELGTVVQHATSPGASNGTPIPLCISMSVIVPT
SS
Download sequence
Identical sequences A0A2G5EGR0
Aquca_008_00005.1|PACid:22061768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]