SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5EH03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5EH03
Domain Number 1 Region: 359-497
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.73e-22
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0041
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000128
Family Domains B1 and B5 of PheRS-beta, PheT 0.0055
Further Details:      
 
Domain Number 3 Region: 292-366
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000256
Family Domains B1 and B5 of PheRS-beta, PheT 0.0088
Further Details:      
 
Weak hits

Sequence:  A0A2G5EH03
Domain Number - Region: 204-244
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000126
Family B3/B4 domain of PheRS, PheT 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5EH03
Sequence length 498
Comment (tr|A0A2G5EH03|A0A2G5EH03_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA54971.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_00800011v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MPKVPVGRDRLFRVLGKEYTQEEFEDLCFEYGLELDDVATEEDEVIYKIEVAANRYDLLC
FEGLVQSLRIFNGLDQIPKYIVTNIPRESMLKINVKPETALVRPFVVCAVLRDITFDQAS
YKSFIDLQDMLHQNICRGRTLVAIGTHDLDTIQGPFTYEALPPTEINFVPLKQVKSFRGD
ELMKFYESDLKLKKFLHIIEKSPVFPVIYDCNRTVLSLPPIINGAHSAISLQTKNVFIEC
TATDLTKAKIVLNTMVTMFSMYCKKKFEVEPVEVISSDGHSCVYPDLSPYRMEVPLSKIT
GRIGVSADANQVISLLNRMQLLAEKSVSSGDECSIIVSVPPTRSDVLEACDVAEDFAIAY
GFENILAKISSSTQGGGEQSLSQISNLIRLEFAMSGFTEVLTWILCSYKDITFMLNRKDD
NSTSVKISNPRSSDFEVARTTLMPGLLKTVRENNHHPKPIKIFEVGDVVLLNEMNDVGAR
NRHHLAALYCDDHSGFEV
Download sequence
Identical sequences A0A2G5EH03
Aquca_008_00011.3|PACid:22061632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]