SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5EJ41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5EJ41
Domain Number 1 Region: 223-305,440-574,613-638
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000314
Family Quinoprotein alcohol dehydrogenase-like 0.025
Further Details:      
 
Domain Number 2 Region: 326-367
Classification Level Classification E-value
Superfamily F-box domain 0.000000589
Family F-box domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5EJ41
Sequence length 677
Comment (tr|A0A2G5EJ41|A0A2G5EJ41_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA55782.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_00700240v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MAKMSLCSIPPAYAPSLVFSHGKRFRDQTFCTLSDGCYHVGRVPLMGGMFCVTSSHGWLL
MRSYYYSTECYLFNPISLTKIHLPPVLDITYVAGVLTSSPSDPDCIVMLISNAKRSSIFC
RIGDNKFIEQKLESKKKDPITIKGCISVISCKGKIYLFFKQGMGVVDVHSTFLSIKLHKI
NYPSPSLPWISCYARFFLESCGEIFHVAESRFGISHNLPQKCDVFKLDVSTMDWVMVDNL
GDQIFLLGLYSTSVPATDLGLKPGCIYFCLYGDTSLYMFDMHDGTITNTLPCPKKIPYWK
GPFWVVPNCKFQVKKEVVKLQESTHQGNQEWGWKDLPVELLELIASFLFLGDCIRFRLTC
KSWISVTPPLRANCLFNKFEFEPPQVPWLMSFPKTNQGVCKLYHPVYGDAYTMNIPELAD
AIIRNAKYGWLLMSQGISFFFFNPITMEVIKLPDIERDYQFIGMSFSSPPTSSDFVVFGF
LGFYMVVYRKGEERWSRDFFKSSHWEFLHSPCNPIFYDGAFYCLGKNGRLLLFDTKEVVK
ESQYSDITKSNESFIVEYDGEILSIFVGPKGKKIFIFKLDLCNMKWCKLESLDDKVLFLS
HTASILLPAAAVGLKGIENRIYFPRFHESDNMFYSLSTRKYQCCGSRYSCDDWISTSKLS
HCSWIQSGHNSSMSLTM
Download sequence
Identical sequences A0A2G5EJ41
Aquca_007_00240.1|PACid:22047854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]