SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5EJT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5EJT9
Domain Number 1 Region: 130-272
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.54e-46
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 861-922
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000981
Family PB1 domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5EJT9
Sequence length 938
Comment (tr|A0A2G5EJT9|A0A2G5EJT9_AQUCA) Auxin response factor {ECO:0000256|RuleBase:RU004561} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_00700393v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MSAVEEKSKPVAVTPTLLEEMKIFKELQDQSGTRKSIHSELWHACAGPLVSLPQVGSLVY
YFPQGHSEQVAVSTKRPATSHIPNYPNLPSQLMCQVHNVTLHAEKDTDEIFAQMTLQPVN
SEKDVYPVPDFGLKSSKHPSEFFCKTLTASDTSTHGGFSVPRRAAEKLFPQLDYTVQPPT
QELVVRDLHNNTWTFRHIYRGQPKRHLLTTGWSVFVGSKRLRAGDAVLFIRDEKSQLLLG
VRRANHQQTTLPSSVLSADSMHIGVLAAAAHAAANRSPFTIFYNPRACPAEFVVPLAKYQ
KAVYGTQVSIGMRFGMMFETEESSKRRYMGTIVGISDLDPLRWPNSKWRNLQVEWDESGG
GERQNRVSLWEIETPESLFVFSSLTSGFKRPLPPAFAGSETEWGSLIRRPFIQIPESGNV
NIPCPPIPSLGSEQLIKMLMKPPIVSTSGAFSSSLPACVIKGNAMQDGAKLSHTMHQQKP
QSISLQSTSVVHQTPPQQCTDPSNPLDPKTISQAPVPEKAHTRNSVENQLLRKTRTVKSE
ISFTDPSDRHRQMSEKCSEDKLVGTFTNPKNLSNEPSFPNQGPLQLQNDQQYVQHQLEPN
VVTVNPHHIDATQFEMNNLNSLFPYPSQFPSQYLDTDDWLQPPTCHSLLGNFKSPGSMSG
FEGCPAQDTSITYPDYVNQILPTYGSELGGPEMNYLGFFSQPDQLAQCPLQDSSTLQSVS
NSCGLRDASEESKGHSGIYDALNFEAINSGSAVVDPSVSSGVLNRFSSFGNVNFKNPEFL
VGGFSSSQDVQSQITTASLADSQGFSLQEIQDNSGGTSSSNVDFDESSLFQQGPWKQVSP
PLRTYTKVQKVGSVGRSIDVTRFNGYEELRSAIGCMFGLEGVLDDPRGSEWRLVYVDYEN
DVLLVGDDPWEEFVTCVRCIRILSPSEVQQMSEDGLLQ
Download sequence
Identical sequences A0A2G5EJT9
Aquca_007_00393.1|PACid:22047861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]