SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5ELV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5ELV9
Domain Number 1 Region: 49-289,337-413
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.11e-47
Family WD40-repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5ELV9
Sequence length 493
Comment (tr|A0A2G5ELV9|A0A2G5ELV9_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA56733.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_00700825v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MSKRLKTNGVGGGGGVKGSDVVGLWNREVGEFTPRAFAYRFKASEDLVLRLDIYNKLQKH
RGCVNTVSFNASGDILVSGSDDRMVMMWDWDAGRVKLSFHSGHHNNIFQAKIMPYSDDRS
IVTCAADGQVRHAQISENGTVETTMLAKHQGRTHKLAIEPGSPLIFYTCGEDGLVQHFDL
RRGTSTELFTCKSFLNKSRYTPIIHLNTIAINPTNPNLFAVGGSDEFARVFDIRKYKWDG
SATFGQPADCFCPPHLIGDGQVGITGLAFSDQSELLVSYNDEHIYLFTKDMGLGTDPVPA
SPSSVESNVSGIAHDSAMVTSPSSNEAVDEISGPQVYKGHSNSDTVKGVSFFGPRDEYVV
SGSDCGRIFIWRKKDGELMRVMEADKHVVNCIEPHPHDPLLASSGIEHDIKIWTPKANNK
ATLPISVEEVVIPDRIAFFAIDDDYGDDDDDMDDDDDFDDSDIDDDDDDDDFDSDDDDDC
DCDIDNDKGVDDD
Download sequence
Identical sequences A0A2G5ELV9
Aquca_007_00825.1|PACid:22047767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]