SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5ETB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5ETB8
Domain Number 1 Region: 12-272,306-362
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.31e-56
Family WD40-repeat 0.00048
Further Details:      
 
Weak hits

Sequence:  A0A2G5ETB8
Domain Number - Region: 673-816
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000989
Family WD40-repeat 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5ETB8
Sequence length 1012
Comment (tr|A0A2G5ETB8|A0A2G5ETB8_AQUCA) Protein HIRA {ECO:0000256|RuleBase:RU364014} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_00400080v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MIAEKPDWIKHEGSQIFSIDIQPGGLRFATGGGDHKVRIWNMLCVGKESEGDQSAERVLA
TLSDHFGSVNCVRWAKHGRYLASGSDDQMIHIHERKPGTGTSEFGSGEPADVENWKVAMT
FRGHTADVVDINFAPDDTLLASGSLDNTVHIWNLSNGTCTTVLRGHSSLVKGVAWDPIGS
FIATQSDDKTVIIWRTKDWSLCHRTDGHWAKSLGSTFFRRLGWSPCGHFITTTHGFQKPR
HSAPVLERGEWAATFDFLGHNAPIIVVKFNHSMFRRSISNGQDAKALPVGWSNGTSKIAA
KDTQPYNVIAIGSQDRTITVWTTASPRPLFVAKHFFSQSVVDLSWSPDGYALFACSLDGT
VATFHFEVKELGHRLSDAELDELRRHRYGEGRGKVTKMAESPAQLLLETASLKESANKKL
SPSLQNQTTGKKSVDLGVTSVDQPLKKVSNSQIENGKKKGSNGSDRSNKMANSTQKSSPV
KLKQKEYTGADGRKRIIAVGLPAQPERTSAGVEALAVGFPRIASNNQKDVNVEGGLPVGS
VKINGSSEEYNLAGGSGHGGVKEQSGYTARATISEKLVIEKVPIATSTDVRASVDRSEIV
KASDSKPFSSSTLSITVYNTKEGKDSIPVCLEAHAVEQAVNDVVGIGNVLTSKETEVTCT
HGDQTLWSDKLSGKVTVLAGNANFWAVGCADGCLQVYTKCGRRAMPTMMMGSAAIFIDCD
ECWKLLLITRKGSIYVWDLFNNTCLLHDSLDSLITSGHELPAKDSGTMQVISARFSKSGS
PLVILATRHAFLFDMSLKCWMRIADDCFPASSFASSWSSGSIRSGELAALQVDIGKYLAR
KPSWSRVTNDGVQTRAHLESQLASSLALQSPNEYRQCLLSYIRFLAREADESRLREVCES
FLGPPVGMVEATCSDPTKMTWDPCVLGIDKHKLLREDILPAMASNRKVQRLLNEFINLLS
EYGTNESSNIQVHPTPTAIPQVVPITPAKDQVPSQPVAEQVDPALPTKEINS
Download sequence
Identical sequences A0A2G5ETB8
Aquca_004_00080.1|PACid:22030398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]