SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5ETG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5ETG6
Domain Number 1 Region: 8-278
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.51e-59
Family WD40-repeat 0.0000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5ETG6
Sequence length 279
Comment (tr|A0A2G5ETG6|A0A2G5ETG6_AQUCA) Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog {ECO:0000256|HAMAP-Rule:MF_03037} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_00400131v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MDLLEKKMELKEIQKLEGHTDRVWSLAWNPTTGVAGIPAMLASCSGDKTVRIWQQNTSLP
SNPWECKAVLDETHTRTVRSCAWSPSGKLLATGSFDATTAIWEHVGDDFECVATLEGHEN
EVKSVSWNSSGSLLATCSRDKSVWIWEVLPGNEFECVSVLQGHTQDVKMVQWHPFMDVLF
SCSYDNTIKVWAGDDDSDDWECLQTLNESNNGHSSTVWALSFNSTGDKMVTCSDDLTLKV
WGNDSATKQTNGDEFSPWRHLCTLSGFHDRTIFSVHWSR
Download sequence
Identical sequences A0A2G5ETG6
Aquca_004_00131.3|PACid:22029823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]