SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5EZE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5EZE4
Domain Number 1 Region: 52-159
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000186
Family B3 DNA binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5EZE4
Sequence length 165
Comment (tr|A0A2G5EZE4|A0A2G5EZE4_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA61017.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_00100900v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MTTSTVFFDFMPSKEEEEKGVASGEFPLTPIRAQRVEIRNTPPRLLDLLTPWECRKIMTA
SDVGHLGALVLGIEHIQRHWGLDWTAINRGTQVAVIIRDVETRTDHNLLLRKTHDDAFLL
HNNWLRDFVFRRNLKEGDTIGMYWNRTSSSICFSVLKRAIGMRRE
Download sequence
Identical sequences A0A2G5EZE4
Aquca_001_00900.1|PACid:22043661 Aquca_003_00503.1|PACid:22050311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]