SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5F1G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5F1G1
Domain Number 1 Region: 1077-1261
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.3e-28
Family Pyruvate phosphate dikinase, N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5F1G1
Sequence length 1326
Comment (tr|A0A2G5F1G1|A0A2G5F1G1_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA61802.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_00200059v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MSNTLGNSLVHLSLCRTNVLESQSRANCLFQGPAIQATLQLKKSLIPTKFHENCSLKKGK
VSRRVKHMDSIVPSAVLATDAGSGTAGKFKLDGNSEILVDISAPTSGTLLQINFKITNNK
NSLMLHWGGIRDKQKNWVLPSRLPEGTKLYKNQAVRTPFKKSGSDLFLKIEIDNPEIQAI
EFLIVDEAQNKWFKNNGGNFRVPLVHKSRSSSKVAVPEDLVQIQAYLRWERKGKQMYTPE
QEKMEFEEARKELQMELEKGSSLEDIRKKITKGNKQTKVSEQAPKRYSTPKRIQRRQRDV
MTLLNKYAAESIEEKPSVISRVSSPIELFLKAKEEQGCGSILNKQIFKLGEKKILALVTE
AIGKKKVHLATDLGGPLTLHWALSKNVGEWQAPPSSVAPKGSVMLERASETPFADSSSSD
PPYQVQSLEIEIGEENYVGMPFVLRSGENWIKNGGSDFYVNFSNAAKKVKKDVGDGNGTA
KALLEKIAEMESEAQKSFMHRFNIAADLMGWAKDSGELGLAGILVWMRFMATRQLIWNKN
YNVKPREISKAQERLTDLLQDIYKTHPQHRELLRMIMSTVGRGGEGDVGQRIRDEILVIQ
RNNDCKGGMMEEWHQKLHNNTSPDDVVICQALIDHIKSDFDMSVYWKTLNSNGITKERLL
SYDRAIHSEPNLRRDQKDGLLRDLGNYLRTLKAVHSGADLESAIANCMGYKAEGQGFMVG
VSINPISGLPGGFPELLQFVLDHVEDKNVEPLLEGLLEAREELRPLLLKPHDRLRDLLFL
DIALDSTVRTAIERGYEELNNAGSEKIMSFITLALENLALSSDNNEDLIYCLKGWDLAQK
MCKRGDDQWALYAKSVLDRTRLALASKAEHYDKVLQPSAEYLGSLLDVDQWAVNIFTEEI
IRAGSAASLSSLLNRLDPVLRKTANLGSWQVISPIEAVGYVVVVDELLTVQNMTYEKPTI
LVAKSVKGEEEIPDGAVAVLTPDMPDVLSHVSVRARNSKVCFATCFDPNILNDLKEKEGK
LLQLKPTSADIVYSELKDGELLGGSSTTLRDDDSPSLTLVKKQFCGRYAISSEEFTNEMV
GAKSRNISYLKGKVPSWVGIPTSVALPFGVFEKVLSDDSNQKVAATLLSLKRKLGEGDFN
ALGEIRQTVLQLAAPPQLVKELKSTMQGSGMPWPGDEGEKRWEQAWTAIKKVWASKWNER
AYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIYAEVVKGLGETLVG
AYPGRALSFISKKNDLNSPKVLGYPSKPIGLFIRRSIIFRSDSNGEDLEGYAGAGLYDRY
CSFTLI
Download sequence
Identical sequences A0A2G5F1G1
Aquca_002_00059.2|PACid:22052320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]