SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5F2Q5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5F2Q5
Domain Number 1 Region: 8-283
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.18e-48
Family WD40-repeat 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5F2Q5
Sequence length 298
Comment (tr|A0A2G5F2Q5|A0A2G5F2Q5_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA62293.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_00200351v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MPATKIETGHQDIIHDVSMDYYGKRIATASSDSTIKIIDVNNNNNTIVANLTGHQGPVWQ
VTWAHPKFGTILASSSYDGKVILWKESANQWTQVHVFNEHKSSVNSISWAPHDLGLLLAC
GSSDGNVYVHSARSDGGWETVKIEKAHGVGVSSVSWAPALAPGVLVSSGENDFVQKLVSG
GCDNMIKIWKLVNGNWIVDSVLEKHTDLVRDVAWAPNFGLPKSTIASASQDGTVIIWTVG
KEGEKWEGKILKDFKTQVWRVSWSLTGNILAVSDGNNDVTLWKEAVDGEWQQVTTVAP
Download sequence
Identical sequences A0A2G5F2Q5
Aquca_002_00351.1|PACid:22051958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]