SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5F699 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5F699
Domain Number 1 Region: 183-287
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.79e-31
Family B3 DNA binding domain 0.00000725
Further Details:      
 
Domain Number 2 Region: 59-115
Classification Level Classification E-value
Superfamily DNA-binding domain 2.16e-16
Family GCC-box binding domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5F699
Sequence length 355
Comment (tr|A0A2G5F699|A0A2G5F699_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA63533.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_00201106v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MDSSSCIDESTTSDSTPAMVIASPEKESPDKLCRVGSGASVVVDSEGGVEAESRKLPSSQ
YKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAAKSYDIAAQRFRGRDAVTNFKPLSSS
DEDNIEAAFLSSHSKAEIVDMLRKHTYNDELEQSKRNYGININKGKEFMGCNRSNRTSNA
RENLFEKTVTPSDVGKLNRLVIPKQHAEKNFPLQIGSISKGMLLNFEDNSGKVWRFRYSY
WNSSQSYVLTKGWSRFVKEKCLKAGDVISFQRSSGQDKQLYIDWKARNNEPISSMVLVHS
IQPVNPVQVIRLFGVNIFEIPISSNNSNCNGKRLRDVEPFSLESACKKPSIVEAL
Download sequence
Identical sequences A0A2G5F699
Aquca_002_01106.1|PACid:22052086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]