SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5F747 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5F747
Domain Number 1 Region: 13-311
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.75e-46
Family Quinoprotein alcohol dehydrogenase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5F747
Sequence length 475
Comment (tr|A0A2G5F747|A0A2G5F747_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA63831.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_00201277v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MMKEALVVCSDKSLSAGITVWDIETGDHLLHIPTCASPPHGLVCLRNHFLVASQIQKQGS
VAGGAIFIWPLNKPHAPLRNYPIEATGPLCCTKDGLYLAGGTLSGKAYVWEVSSGRMLKC
WHAHKKSLTCLNFSSDNSFLISGSNEGEIRVWSTISLLDMTDFQSVPSFFHAWMEHQSSI
TGLLTSDISSSVLISSSLDGTCKIWDLISNKVVRTHAFPLAITAITLDPEERFLFSGSSD
GRIFVNTLDAGLEEENEVLSEEQSLMVLSGHKGAITALSFSLSGLFLISASEDCTACLWD
VKSWAVIHNFSHKKAGHITNIVVIPQSLLLPRTENLHKVSFQFRVSPLDKYPQPESTAKR
SVTLLPKYCSLEHDHIMSGFQITHTMNQQIMDLEQDRTPEAIQMKVDTIVERRLWATSMA
KHVTEMNKHLRSRLLDLMQSRLSCPLEFSAIGKRRQFGASSVSPAGDECREYPTY
Download sequence
Identical sequences A0A2G5F747
Aquca_002_01277.1|PACid:22052187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]