SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5FB53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2G5FB53
Domain Number - Region: 26-75
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000149
Family B3 DNA binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5FB53
Sequence length 238
Comment (tr|A0A2G5FB53|A0A2G5FB53_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA65228.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_00100601v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MAELKLKQKGDNPSPSIVRMKRNKFFRVIKSRYPQIEFPSEFVEEHGYKLPDELVLKVRT
GDFWNIKVKKFGERIRTLRDAEIDYPLKPHKFKNTIHGGAKLGESTNKECVKNSTKNLGM
TSPREDTHQRTEHGEPSVYRANEDMAPEDVPAPKQVSCDTPAVSPSQTNADGVGQRTGSF
NSKYPFFKITMGRSYINQASVVSSLSERLYVEHNTHTVYAYVSEICFAFCSLYQSHLL
Download sequence
Identical sequences A0A2G5FB53
Aquca_001_00601.2|PACid:22044269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]