SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G8NPP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2G8NPP2
Domain Number - Region: 92-135
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000589
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G8NPP2
Sequence length 141
Comment (tr|A0A2G8NPP2|A0A2G8NPP2_9SYNE) Nodulation efficiency family protein {ECO:0000313|EMBL:PIK86806.1} OX=1353266 OS=Synechococcus sp. 63AY4M2. GN=SYN63AY4M2_10455 OC=Synechococcus.
Sequence
MVWPWVVFGLVLIAAELFLPELVAGPAGVAALGAALLAYWGWPVWAQFSAWIVLSLGLIV
LSRRLLPSTSTQLEDLLKESREARAVTAIPPGKRGRVSYLGSTWNAKCSVPDLEIQPGQE
LYVVDRQGNTLIVMPMQMLKS
Download sequence
Identical sequences A0A2G8NPP2 A0A2G8NSD2 A0A2G8P559 A0A2G8PFR7 A0A2G8PM44 A0A2G8PWE0 Q2JSN2
gi|86606837|ref|YP_475600.1| 2010337915 WP_011431010.1.8981 321327.CYA_2197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]