SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G8NVM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G8NVM1
Domain Number 1 Region: 37-92
Classification Level Classification E-value
Superfamily Rubredoxin-like 6.9e-22
Family Rubredoxin 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G8NVM1
Sequence length 138
Comment (tr|A0A2G8NVM1|A0A2G8NVM1_9SYNE) Rubredoxin {ECO:0000256|RuleBase:RU003820} OX=1353265 OS=Synechococcus sp. 65AY6A5. GN=SYN65AY6A5_07170 OC=Synechococcus.
Sequence
MNGSQPDPVNQPKPSRVPKLIELPEDETDAQVGDPLRMQRYECRSCGYVYEPAKGDQLNR
IPAGVPFEELPADWRCPVCRAGKRLFQAVGAKGKPSGFQENLRYGLGVNVMTPAQKNLLI
FLGLALGFLFLMSFYFVE
Download sequence
Identical sequences A0A2G8NL84 A0A2G8NVM1 A0A2G8P1I1 A0A2G8PC82 A0A2G8PIM7 A0A2G8PQX7
2010338115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]