SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G9F281 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G9F281
Domain Number 1 Region: 119-270
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 2.49e-51
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.0000691
Further Details:      
 
Domain Number 2 Region: 2-118
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 3.89e-36
Family DHN aldolase/epimerase 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G9F281
Sequence length 275
Comment (tr|A0A2G9F281|A0A2G9F281_9FUSO) 7,8-dihydroneopterin aldolase {ECO:0000256|RuleBase:RU362079} OX=143387 OS=Fusobacterium necrophorum subsp. funduliforme. GN=CI112_09390 OC=Fusobacterium.
Sequence
MDKIYIENLEFRAYHGVFPEEKKLGQKFIVSLELELDTREAALSNNLEKTLHYGLISERV
QSIVLEKSYDLLESLAEKIAETLLLEYPLLQGVKVRVDKPQAPIPLPFRTVAVEIYRSWH
KVYLSLGSNLGEKTANLERAIQEISSLKHTSLCKKSSFLETEPFGYVEQDFFVNACIEVK
TLLTAKELLASCLAIEEKMGRKRVRKWGPRNIDIDILFYDKEIYDEEDLVIPHPWIEERM
FVLEPLCEIAPNYIHPILKKTIFMLKRGIGHETTV
Download sequence
Identical sequences A0A2G9F281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]