SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2H1M3Z6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H1M3Z6
Domain Number 1 Region: 4-207
Classification Level Classification E-value
Superfamily Formyltransferase 6.67e-62
Family Formyltransferase 0.0000054
Further Details:      
 
Domain Number 2 Region: 205-307
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.41e-29
Family Post formyltransferase domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H1M3Z6
Sequence length 318
Comment (tr|A0A2H1M3Z6|A0A2H1M3Z6_LACSK) Methionyl-tRNA formyltransferase {ECO:0000256|HAMAP-Rule:MF_00182, ECO:0000256|SAAS:SAAS00999745} OX=1599 OS=Lactobacillus sakei. GN=LSAJ160_120101 OC=Lactobacillus.
Sequence
MTSIVFMGTPQFSVPILEALVANDYQILAVVTQPDRKVGRKQVLQQTPVKEAAVRLDLPV
FQPEKLSGSPELADVIALQPDLIVTAAYGQFLPTKLLEAAKIAAINVHGSLLPKYRGGAP
IQYAVLNGDSEIGITIMHMAKKMDAGDMIEQASIPIEATDDTGSLFDKLSYVGRDLLLKT
LPGIIAQTAPRTPQDEVQVTFAYNITKEQEQLDINQPAEQLLNQIRALRPQPGAWLAVNG
QRTKIWQATVAETTTDQAAGVVVALNKKDFELAAGNGTVLKITEIQPAGKAKMPVQSYLN
GVGKQLAVGQQVVVQDAE
Download sequence
Identical sequences A0A2H1M3Z6 Q38XT6
WP_011374398.1.13714 WP_011374398.1.42590 gi|81428304|ref|YP_395304.1| 314315.LSA0689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]