SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2H3JFI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3JFI8
Domain Number 1 Region: 95-220
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000111
Family CBS-domain pair 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H3JFI8
Sequence length 406
Comment (tr|A0A2H3JFI8|A0A2H3JFI8_WOLCO) Uncharacterized protein {ECO:0000313|EMBL:PCH34757.1} KW=Complete proteome; Reference proteome OX=742152 OS=Wolfiporia cocos (strain MD-104) (Brown rot fungus). GN=WOLCODRAFT_78548 OC=Agaricomycetes; Polyporales; Wolfiporia.
Sequence
MILIGFDSSFSEIIPQSLCTRYGLYFGAKMAGVVRVLIWTLGIVAYPVAKLLELVLGPHH
GIIYRRAELKELIAMHSNMGELGGDLRTDTVTIIGGALDLQEKVVKQAMTPIENVFMLSI
DSRLDESTLRKICRTGHSRVPVYEEVEIPAPNTGAGSSKTIKVKKIVGILLVKQCVLLDP
KDATPLRDIPLNRVPLVPHNESLLGILDKFQEGRSHIAIVSRFSVARAASVKQAVKRGLT
QRLRQVVHGSDSESESESDEEEGHHARKWPHLRRKRSDRGEESSENEQTLRESSHGEGSD
DAASRESARPKKMRAFSTRGRRKQKAVDLEMGVVEDKKEESKPKEEPSGSKSRRPSLTLG
RAGFWGREQDMPADAVLSREGAEEVRAQSILCRRDADAMTCSSSKA
Download sequence
Identical sequences A0A2H3JFI8
jgi|Wolco1|78548|e_gw1.10.275.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]