SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2H6HGK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H6HGK2
Domain Number 1 Region: 2-293
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.9e-72
Family Protein kinases, catalytic subunit 0.000000687
Further Details:      
 
Domain Number 2 Region: 635-698
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000863
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 566-630
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000484
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H6HGK2
Sequence length 727
Comment (tr|A0A2H6HGK2|A0A2H6HGK2_9BACT) Serine/threonine-protein kinase PknB {ECO:0000313|EMBL:GBE25351.1} OX=2005725 OS=bacterium BMS3Bbin02. GN=BMS3Bbin02_01636 OC=Bacteria.
Sequence
MADVWEAEDQLLNRRVAVKMLHPQFARDEAFVSRFRKEAQNAANLTHPNIVAIYDWGEEG
DTYFMVMELIDGRTLRDVLRSEGAFLARRAVEIAAESAAALTVAHEAGVFHRDVKSGNIL
LTPDGSVKVTDFGIARALDDSEELTKTGAVIGTATYFSPEQAQGLPADGRSDIYSLGVVL
FELVTGQPPFSGESPVAVAYQHVSELAPPASSINADVPAALEMIIEKCLEKDPGARYQSA
IELRNDLLRFLRGEAPTAVPGLAPPPLVPVGYEPQTPIEPTPQPDAATQVIHGAYTANQP
PPPPTATPDEVGRHVSYQPPPEERESQLTYILMVVGLVAVLGLGLFFLSRVMSPPDPVVA
DVVVPSLAGQADNDAFSTLQALDLKVSRTLEFSANIDAGLVIKTDPPAGDRVLPGTLVEV
WISKGEETSKIPSLVDQNIEDAKRSIIANGFLVGTITIDETSGAEEGTVLRQNPLPASDH
PAGTSIDLVVSGGPFAVFIPDVANMTEESARLTLDRAGFSDIQVIEEFSLDVEEGLVIRS
EPGANNLQDRKRPVTIVMSLGPEPFALPDFVGLSVQDAQNLASQKGLTMILDTETVDVTA
ASGLGGLIANQDIIQGTEVRAGDTITLTLGVLIQVAMPNLVGMSVDDARAALALIGLQLE
VLADLDVAPDSGLVGLVADQIPNPGDLIDDGSTVGVWVGVLPPTTTTTTTTTTTLPPTTT
TTTTAAP
Download sequence
Identical sequences A0A2H6HGK2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]