SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H6LQZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H6LQZ0
Domain Number 1 Region: 36-90
Classification Level Classification E-value
Superfamily Rubredoxin-like 9.26e-21
Family Rubredoxin 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H6LQZ0
Sequence length 136
Comment (tr|A0A2H6LQZ0|A0A2H6LQZ0_9NOSO) Rubredoxin {ECO:0000256|RuleBase:RU003820} OX=1861711 OS=Nostoc cycadae WK-1. GN=NCWK1_5410 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MIEKSNSYVIIFNVYLIIPLWETLAMSEQAVETPALDRYECRACGYVYEPEKGDDKHDIP
SGTLFTELPVNWRCPVCSAKKTAFTNIGPSGTASGFKENLGFGLGVNKLTPGQKNILIFG
ALALAFLFFISLYGLQ
Download sequence
Identical sequences A0A2H6LQZ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]