SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2H9XL26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H9XL26
Domain Number 1 Region: 5-275
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.69e-96
Family Methylenetetrahydrofolate reductase 0.000000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H9XL26
Sequence length 276
Comment (tr|A0A2H9XL26|A0A2H9XL26_BURGL) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} OX=1176514 OS=Burkholderia glumae AU6208. GN=Y5A_016145 OC=Burkholderiaceae; Burkholderia.
Sequence
MKPIELSLEFFPPKTAEGVDKLRATRAQLLPLKPKFVSVTFGAGGSTQQGTLDTVLDMQK
DGLLAAPHLSCIGASKDNLRAVLDQYRSHGIRHIVALRGDLPSGMGEVGELRYASELVSF
IRAEHGDWFRLEVAAYPEYHPQSRSPKLDLLHFAEKVKAGANSAITQYFFNADAYFRFVD
DARKLGVDVPIVPGIMPITNFTQLMRFSEMCGAEVPRWVARRLESFGDDKESIRAFGADV
VTAMCERLIREGAPGLHFYTLNAATATKVVCERLGF
Download sequence
Identical sequences A0A2H9XL26 A0A2J9HED4 C5A8X3
WP_012734301.1.31674 WP_012734301.1.43144 WP_012734301.1.53941 WP_012734301.1.99142 gi|238025875|ref|YP_002910106.1| 626418.bglu_1g02010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]