SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I0MI64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0MI64
Domain Number 1 Region: 1-261
Classification Level Classification E-value
Superfamily YWTD domain 7.19e-56
Family YWTD domain 0.00000205
Further Details:      
 
Domain Number 2 Region: 613-868
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-55
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 3 Region: 312-542
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-49
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 4 Region: 915-1174
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-39
Family YWTD domain 0.0000538
Further Details:      
 
Domain Number 5 Region: 1305-1340
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1226-1266
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 7 Region: 871-916
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000367
Family EGF-type module 0.039
Further Details:      
 
Domain Number 8 Region: 1267-1302
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 568-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000203
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 266-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000381
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 11 Region: 1183-1236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000684
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I0MI64
Sequence length 1585
Comment (tr|A0A2I0MI64|A0A2I0MI64_COLLI) Low density lipoprotein receptor-related protein 5, transcript variant X1 {ECO:0000313|EMBL:PKK29369.1} KW=Complete proteome; Reference proteome OX=8932 OS=Columba livia (Rock dove). GN=A306_00004580 OC=Coelurosauria; Aves; Neognathae; Columbiformes; Columbidae; Columba.
Sequence
PFLLFANRRDVRLVDAGGTKLESTVVVSGLEDAAAVDFQYSQGIVFWTDVSEEAIKQTYI
NQTGNVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLDQ
PRAIALDPAHGYMYWTDWGETPRIERAGMDSSTRKIIVDSDIYWPNGLTIDLDEQKLYWA
DAKLSFIHRANLDGSFRQKVVEGTLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRR
EILSALYSPMDIQVLSPDRQPYFHTPCEESNGGCSHLCLLSPRDPFYSCACPTGVQLEDD
GRTCKSGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAIAIDYDPVEGYIYWTDD
DVRAIRRAYLDGSGAQTLVTTEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKI
LISENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSERRVLVNTSLGWPNGLALDL
EKDKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVH
KIKASRDIIIDQLPDLMGLKATSVTKVFGTNSCAESNGGCSHLCFFTPQETRCACPIGLE
LLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSDNRIYWT
DVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGRNLYWADTGTNRIEVARLDGQHR
QVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSITLVDKVGRANDLTID
YADQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTDWNLHSIERAD
KTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCLAIPNGFRCGCAAHY
TLDPNSRNCSSPASFLLFSQKSAISRMIPDDQRSPDIILPMHGLRNVKAIDYDPLDKLIY
WVDGRQNIIKRAKDDGTQPFTVMSTPNQSQNPEKQPHDLSIDIYSHTLYWTCEATNSVNV
HRLNGESIGMVLRGDHDKPRAIVVNAERGYMYFTNMQDRAPKIERAALDGTEREVLFTTG
LIRPVALVIDNKLGKLFWVDADLKRIESCDLSGANRVTLEDSNILQPMGLTVLGNHLYWI
DRQQQMIERVEKINGYKRTRIQGRIAHLTGIHAVEELDMEEFSVHPCSHDNGGCSHICIA
KGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGFPECDDQS
DEDNCPICSASQYQCEKGQCIDVHLRCNGEIDCQDKSDEADCDTICLPNQFRCASGQCIL
LKQQCDSFPDCIDGSDELMCEKTKPASDEAQPHSSAIGPVIGIILSLFVMGGMYFVCQRV
VCQRYAGPNSHFPHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGKSVISSMSLMGGSSGA
PLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLYNAEMFYSSNIPSTTRSYRP
YLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDSDPYPPPPTPRSQYMSAEESC
PPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A2I0MI64

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]