SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I0MKN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0MKN4
Domain Number 1 Region: 606-861
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-56
Family YWTD domain 0.00000312
Further Details:      
 
Domain Number 2 Region: 3-254
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-52
Family YWTD domain 0.00000188
Further Details:      
 
Domain Number 3 Region: 305-540
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-49
Family YWTD domain 0.00000317
Further Details:      
 
Domain Number 4 Region: 909-1168
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-40
Family YWTD domain 0.0000393
Further Details:      
 
Domain Number 5 Region: 863-911
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1299-1337
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000124
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1221-1259
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 561-608
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000212
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1261-1297
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 257-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000305
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1178-1231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000444
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I0MKN4
Sequence length 1586
Comment (tr|A0A2I0MKN4|A0A2I0MKN4_COLLI) Low density lipoprotein receptor-related protein 6 {ECO:0000313|EMBL:PKK30239.1} KW=Complete proteome; Reference proteome OX=8932 OS=Columba livia (Rock dove). GN=A306_00004397 OC=Coelurosauria; Aves; Neognathae; Columbiformes; Columbidae; Columba.
Sequence
NRRDLRLVDAANGKENATVIVGGLEDAAAVDFVFVKGLIYWSDVSEEAIKRTEFNKSGSV
QNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALD
PARGFMYWTDWGEVPKIERAGMDGSSRSIIVNTDIYWPNGLTLDYEEAKLYWADAKLNFI
HKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYSGEDLREIHSNIF
SPMDIHAFSQKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGVKLLENGKTCKDG
ATELLLLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYIYWTDDEVRAIRR
SFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLE
EPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNGLALDYAEGKIYW
GDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTLLGDYVYWTDWQRRSIERVHKRTAERE
IIIDQLPDLMGLKATNVHQIIGTNPCAEDNGGCSHLCLYRPQGLRCACPIGLELINDMKT
CIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTI
SRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVAKLDGQHRQVLVWKD
LDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGTERTTLVPNVGRANGLTIDYAKRRLY
WTDLDTNLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNR
TIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNSDN
RTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQ
NIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCEATNVINVTRLDGR
PMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIA
LAIDSQLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDRQQQM
IEKIDMTGREGRTKVQARIAQLSDIHAVKQLNIQEYRQHPCSQDNGGCSHICIVKGDGTT
RCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDEKNCP
VCSDTQFQCESGQCIESALRCNGEANCQDNSDEKNCEVLCLNDQFRCASGQCIGKSKKCD
HNLDCSDSSDEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFICQRVLCPRMKGDG
ETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVT
GASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFA
PPTTPCSTDVCDSDYAPSRRVTAATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESC
PPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A2I0MKN4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]