SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I0MN10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0MN10
Domain Number 1 Region: 684-831
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.75e-41
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1012-1111
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-30
Family Ras-binding domain, RBD 0.00086
Further Details:      
 
Domain Number 3 Region: 226-359
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-22
Family Phosphotyrosine-binding domain (PTB) 0.02
Further Details:      
 
Domain Number 4 Region: 7-99
Classification Level Classification E-value
Superfamily PDZ domain-like 2.26e-20
Family PDZ domain 0.011
Further Details:      
 
Domain Number 5 Region: 957-1026
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000114
Family Ras-binding domain, RBD 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I0MN10
Sequence length 1393
Comment (tr|A0A2I0MN10|A0A2I0MN10_COLLI) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:PKK31060.1} KW=Complete proteome; Reference proteome OX=8932 OS=Columba livia (Rock dove). GN=A306_00003370 OC=Coelurosauria; Aves; Neognathae; Columbiformes; Columbidae; Columba.
Sequence
MYRPAETVKRRLNMHAPPRIRSVEVARGRAGYGFTLSGQAPCVLSCVMKGSPADYVGLKA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGISHIDSCSSDEEVGFYDGKGWL
KPKPDSKALGINRAEKVVEEMQSGGIFNMIFENPTLCAGSSDHSAPKQRSFSDSAAIKFE
AGHESVSNPNLLSKEEIAKVLNDDSVFRIGLEGAEDFGLDASILNVAMIVGYLGSIELPS
TTSNLENESLQAIRGCMRRLRAEQKIHSLVMMKIMHDCIQLCSDKSGVVAEYPAEKLAFS
AVCPDDRRFFGLVTMQTNDDASLAQDAEGALRTSCHVFMVDPELFHHKIHQGIARRFGLE
CTADPDTNGCLEFPTSSLPVLQFISVLYRDMGELIEGMRARAFLDGDVDAHQNNSTSSNS
DSGIGNFNQEEKNNRVLVVDLGTNPSKHIPNSIWENPVGRGQNQPASHWNGFCHEQEGNI
PLEVIQNDKSQNISKHLSPCARIEVPLVSSRNSIPPSKKNAVGAGNQRWLPVHVLQEWQH
GNVSDQESYTDSTDGWSSVNCGTLPPPMNKIPADRYRVDGSFGQPQLKSHKNEWSKKMFC
MQNKFGPPHSIRKSKEDKKGAKFGHPMGLSQAPPPRSSVRRSFGRSKRFSITRSLDDLES
ATVSDGELNSTDLKDCISENSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPIGVK
YFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQ
AQLADDILNSPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRPLPDPQRV
PSSPTSKHSISSEKSNISTPKKLSGKSKSGRSLNEESGEEDTEKKKRGTFFSWSRSKSLG
KSQKRKENGDYPNDSIQSNGLSYRRESQGSMSSTASLDLSETSRLPAFVPDKEKSPKYCC
VNLPDGSSSKMAVKSGFSIKEVLSGLCEKHGINIAAVDLFLVGGDKPLVLHQDSSILESR
DLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLNLNELVARLNGEQEPL
DLGVPISNLDGQRVVLDEKEPTKGRAFTDKQKGASVKQSATVTTSRNQVSTGEGRTLGKS
NSIKMKGENGKNAREVRLSKREDSIAKIGKKKCQKINLDEAEEFFELISKAQSNRADDQR
GLLRKEDLILPDFLRLPPTGPEPSSSTPAGPKGLTRRVSKNDGKDGSTSPSGKQEPVQNF
SENSVKKMSYSENKHKSALTALHSQKTFSVPFNTALSPIPHAQENNATIWKRQSRELQAE
GIQMVDDENVADLTLVAEGDISSPNSTLLPPPPPTPPSDTSKLPEANYPPPTPLAGNQEK
SGYQRSNSGISRF
Download sequence
Identical sequences A0A2I0MN10
XP_013222497.1.63277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]