SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I0ULH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0ULH7
Domain Number 1 Region: 19-279
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-56
Family YWTD domain 0.00000193
Further Details:      
 
Domain Number 2 Region: 631-886
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-55
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 3 Region: 330-560
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-49
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 4 Region: 933-1192
Classification Level Classification E-value
Superfamily YWTD domain 1.09e-39
Family YWTD domain 0.0000558
Further Details:      
 
Domain Number 5 Region: 1323-1359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1285-1321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1244-1284
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 8 Region: 586-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000362
Family EGF-type module 0.013
Further Details:      
 
Domain Number 9 Region: 889-934
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000371
Family EGF-type module 0.039
Further Details:      
 
Domain Number 10 Region: 284-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1202-1254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I0ULH7
Sequence length 1603
Comment (tr|A0A2I0ULH7|A0A2I0ULH7_LIMLA) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} OX=1758121 OS=Limosa lapponica baueri. GN=llap_2851 OC=Limosa.
Sequence
MVTSLYLAAAFPAISAASPFLLFANRRDVRLVDAGGTKLESTVVVSGLEDAAAVDFQYSQ
GIVFWTDVSEEAIKQTYINQTGSVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEV
ANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSTRKIIVDSDI
YWPNGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTD
WQTRSIHACNKRTGEKRREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSP
RDPFYSCACPTGVQLEDDGRTCKSGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRH
AIAIDYDPVEGYIYWTDDDVRAIRRAYLDGSGAQTLVTTEINHPDGIAVDWVARNLYWTD
TGTDRIEVTRLNGTSRKILISENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSER
RVLVNTSLGWPNGLALDLEKDKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLL
GDYIYWTDWQRRSIERVHKIKASRDIIIDQLPDLMGLKATSVTKVFGTNSCAENNGGCSH
LCFFTPQETRCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGV
KEASALDFDVSDNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYW
ADTGTNRIEVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGT
NSITLVDKVGRANDLTIDYADQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQY
SDYIYWTDWNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCG
HLCLAIPNGFRCGCAAHYTLDPNSRNCSSPASFLLFSQKSAISRMIPDDQQSPDIILPVH
GLRNVKAIDYDPLDKLIYWVDGRQNIIKRAKDDGTQPFTVMSTPNQSQNPEKQPHDLSID
IYSHTLYWTCEATNSVNVHRLNGESIGMVLRGDHDRPRAIVVNAERGYMYFTNMQERAPK
IERAALDGTEREVLFTTGLIRPVALVIDNKLGKLFWVDADLKRIESCDLSGANRVTLEDS
NILQPMGLTVLGNHLYWIDRQQQMIERVEKVNGYKRTRIQGRIAHLTGIHAVEELDMEEF
SAHPCSRDNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGEID
CIPMAWRCDGFPECDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEADC
DTVCLPNQFRCASGQCILLKQQCDSFPDCMDGSDELMCEKTKPASDESQPHSSAIGPVIG
IILSLFVMGGMYFVCQRVVCQRYPGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGIS
CGKSMISSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLYN
AEMFYSSNIPSTTRSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDSDP
YPPPPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A2I0ULH7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]