SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I2YE88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I2YE88
Domain Number 1 Region: 20-99
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000127
Family I set domains 0.00067
Further Details:      
 
Domain Number 2 Region: 104-186
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000197
Family I set domains 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I2YE88
Sequence length 279
Comment (tr|A0A2I2YE88|A0A2I2YE88_GORGO) Uncharacterized protein {ECO:0000313|Ensembl:ENSGGOP00000033120} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN= OC=Catarrhini; Hominidae; Gorilla.
Sequence
MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNG
TATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFTEGEPL
ALRCHAWKDKLVYNVLYYQNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAG
ISVTVKGLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKELKRKKKWNLEISLDSGHEK
KVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAK
Download sequence
Identical sequences A0A2I2YE88
XP_004026504.1.27298 XP_018864895.1.27298 ENSGGOP00000016882 ENSGGOP00000016882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]