SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I3FSG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3FSG2
Domain Number 1 Region: 103-201
Classification Level Classification E-value
Superfamily POZ domain 3.49e-24
Family BTB/POZ domain 0.003
Further Details:      
 
Domain Number 2 Region: 270-374
Classification Level Classification E-value
Superfamily POZ domain 4.71e-23
Family BTB/POZ domain 0.02
Further Details:      
 
Domain Number 3 Region: 5-78
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000466
Family Ankyrin repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3FSG2
Sequence length 478
Comment (tr|A0A2I3FSG2|A0A2I3FSG2_NOMLE) Ankyrin repeat and BTB domain containing 1 {ECO:0000313|Ensembl:ENSNLEP00000024807} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=ABTB1 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MDTSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPLYYACLCGHEELVLYLLANGA
RCEANTFDGERCLYGALSDPIRRALRDYKQVTASCRRRDYYDDFLQRLLEQGIHSDVVFV
VHGKPFRVHRCVLGARSAYFANMLDTKWKGKSVVVLRHPLINPVAFGALLQYLYTGRLDI
GVEHVSDCERLAKQCQLWDLLSDLEAKCEKVSEFVASKPGTCVKVLTIEPPPADPRLRED
MALLADCALPPELRGDLWELPFPCPDGFNSCPDICFRVAGCSFLCHKAFFCGRSDYFRAL
LDDHFRESEEPVTSGGPPAVTLHGISPDVFTHVLYYVYSDHTELSPEAAYDVLSVADMYL
LPGLKRLCGRSLAQVLDEDTVVGVWRVAKLFRLARLEDQCTEYMAKVIEKLVEREDFVEA
VKEEAAAVAARQETDSIPLVDDIRFHVASTVQTYSAIEEAQQRLQALEDLLVSIGLDC
Download sequence
Identical sequences A0A2I3FSG2
ENSNLEP00000017236 XP_003279928.1.23891 ENSNLEP00000017236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]