SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I3HIW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3HIW5
Domain Number 1 Region: 34-142
Classification Level Classification E-value
Superfamily Immunoglobulin 5.37e-19
Family V set domains (antibody variable domain-like) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3HIW5
Sequence length 215
Comment (tr|A0A2I3HIW5|A0A2I3HIW5_NOMLE) Sodium voltage-gated channel beta subunit 2 {ECO:0000313|Ensembl:ENSNLEP00000043583} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=SCN2B OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNH
KQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPE
DEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVV
KCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK
Download sequence
Identical sequences A0A2I3HIW5 O60939 Q5U0K8
ENSNLEP00000008973 gi|4759066|ref|NP_004579.1| 9606.ENSP00000278947 ENSP00000278947 ENSP00000278947 NYSGRC-IgSF-SCN2B_HUMAN ENSGGOP00000002064 NP_004579.1.87134 NP_004579.1.92137 XP_003253266.1.23891 ENSNLEP00000008973 ENSGGOP00000002064 ENSP00000278947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]