SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I3N4Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3N4Y0
Domain Number 1 Region: 162-317
Classification Level Classification E-value
Superfamily EF-hand 5.28e-28
Family Calmodulin-like 0.026
Further Details:      
 
Domain Number 2 Region: 33-145
Classification Level Classification E-value
Superfamily EF-hand 9.67e-18
Family Calmodulin-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3N4Y0
Sequence length 323
Comment (tr|A0A2I3N4Y0|A0A2I3N4Y0_PAPAN) Calumenin {ECO:0000313|Ensembl:ENSPANP00000043080} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=CALU OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MKETDLIIMDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAF
LGAEEAKTFDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQ
WQEFDMNQDGLISWDEYRNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIAT
KEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKT
EREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVD
KYDLFVGSQATDFGEALVRHDEF
Download sequence
Identical sequences A0A2I2YZM2 A0A2I3HNY1 A0A2I3N4Y0 A0A2I3SNH9 A0A2K5JLH0 A0A2K5P6T5 A0A2K5V7J9 A0A2K6AHI0 A0A2K6BGW8 F6ZZ73
gi|314122179|ref|NP_001186601.1| ENSP00000438248 ENSP00000438248 ENSP00000438248 NP_001186601.1.87134 NP_001186601.1.92137 XP_009452281.1.37143 XP_011794946.1.43180 XP_011851297.1.47321 XP_014201298.1.60992 XP_016812271.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]