SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I3RBW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3RBW2
Domain Number 1 Region: 66-170
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000108
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 
Domain Number 2 Region: 139-246
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000061
Family C1 set domains (antibody constant domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3RBW2
Sequence length 294
Comment (tr|A0A2I3RBW2|A0A2I3RBW2_PANTR) CD200 molecule {ECO:0000313|Ensembl:ENSPTRP00000062157} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0016225 OC=Catarrhini; Hominidae; Pan.
Sequence
MERLTLTRTIGGPLLTATLLGKTTINDYQVIRMPFCHLSTYSLVWVMAAVVLCTAQVQVV
TQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKIN
ITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDH
LNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQ
VLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP
Download sequence
Identical sequences A0A2I3RBW2 G3RAH4
ENSGGOP00000012446 ENSGGOP00000018770 XP_003825139.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]