SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I3RMD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3RMD6
Domain Number 1 Region: 484-742
Classification Level Classification E-value
Superfamily NHL repeat 3.27e-47
Family NHL repeat 0.00000872
Further Details:      
 
Domain Number 2 Region: 322-418
Classification Level Classification E-value
Superfamily E set domains 8.67e-25
Family Filamin repeat (rod domain) 0.0015
Further Details:      
 
Domain Number 3 Region: 16-91
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000192
Family RING finger domain, C3HC4 0.0059
Further Details:      
 
Domain Number 4 Region: 105-169
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000549
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  A0A2I3RMD6
Domain Number - Region: 154-246
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0418
Family Apolipoprotein A-I 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I3RMD6
Sequence length 744
Comment (tr|A0A2I3RMD6|A0A2I3RMD6_PANTR) Tripartite motif-containing 3 {ECO:0000313|EMBL:JAA03342.1, ECO:0000313|Ensembl:ENSPTRP00000065801} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0005900 OC=Catarrhini; Hominidae; Pan.
Sequence
MAKREDSPGPEVQPMDKQFLVCSICLDRYQCPKVLPCLHTFCERCLQNYIPAQSLTLSCP
VCRQTSILPEQGVSALQNNFFISSLMEAMQQAPDGAHDPEDPHPLSVVAGRPLSCPNHEG
KTMEFYCEACETAMCGECRAGEHREHGTVLLRDVVEQHKAALQRQLEAVRGRLPQLSAAI
ALVGGISQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLETICGAKQKVLQSQLDT
LRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAALAAQAFPERPHENAQLELVL
EVDGLRRSVLNLGALLTTSATAHETVATGEGLRQALVGQPASLTVTTKDKDGRLVRTGSA
ELRAEITGPDGTRLPVPVVDHKNGTYELVYTARTEGELLLSVLLYGQPVRGSPFRVRALR
PGDLPPSPDDVKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSRG
REKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVA
VDTNGDIIVADYDNRWVSIFSPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVF
TFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFG
SHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSGSFLSYINTSAEPLYGPQGLA
LTSDGHVVVADAGNHCFKAYRYLQ
Download sequence
Identical sequences A0A2I3RMD6 O75382
ENSPTRP00000044514 ENSPTRP00000044514 ENSP00000340797 ENSP00000340797 ENSP00000352508 ENSP00000433102 9606.ENSP00000340797 NP_001234935.1.87134 NP_001234935.1.92137 NP_006449.2.87134 NP_006449.2.92137 NP_150594.2.87134 NP_150594.2.92137 XP_003819123.1.60992 XP_003819124.1.60992 XP_003819126.1.60992 XP_011518146.1.92137 XP_016775755.1.37143 XP_016775756.1.37143 XP_016775757.1.37143 XP_016872587.1.92137 ENSP00000340797 ENSP00000352508 ENSP00000433102 gi|32454737|ref|NP_150594.2| gi|32454739|ref|NP_006449.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]