SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I3RNN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3RNN5
Domain Number 1 Region: 610-865
Classification Level Classification E-value
Superfamily YWTD domain 1.29e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 21-258
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-51
Family YWTD domain 0.00000224
Further Details:      
 
Domain Number 3 Region: 309-539
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-51
Family YWTD domain 0.00000282
Further Details:      
 
Domain Number 4 Region: 912-1169
Classification Level Classification E-value
Superfamily YWTD domain 1.26e-37
Family YWTD domain 0.0000699
Further Details:      
 
Domain Number 5 Region: 1300-1336
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1262-1298
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1222-1260
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 565-611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000176
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 9 Region: 868-915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000251
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 264-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000605
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1179-1231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000884
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I3RNN5
Sequence length 1580
Comment (tr|A0A2I3RNN5|A0A2I3RNN5_PANTR) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=LRP5 OC=Catarrhini; Hominidae; Pan.
Sequence
MGRAVPGCSIPGLCILLLESTIVVSGLEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQT
GAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRA
IALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAK
LSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEIL
SALYSPMDIQVLSQERQPFFHTRCEEDNGGCSHLCLLSPSEPFYTCACPTGVQLQDNGRT
CKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVR
AIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVS
EDLDEPRAIALHPVMGLMYWTDWGENPKIECANLDGQERRVLVNASLGWPNGLALDLQEG
KLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVK
ASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPHATRCGCPIGLELLS
DMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVS
LKTISRAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVL
VWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYAD
QRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTS
GRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGHRCGCASHYTLD
PSSRNCSPPTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVD
GRQNIKRAKDDGTQPFVLTSLSQGQNPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLSG
EAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPV
ALVVDNTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPLGLTVLGKHLYWIDRQQQ
MIERVEKTTGDKRTRIQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGT
PRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGC
PVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQC
DSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRY
AGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDR
NHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATARPYRPYIIRG
MAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPA
TERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences A0A2I3RNN5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]