SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I3TFC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3TFC1
Domain Number 1 Region: 27-160
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-44
Family Phosphotyrosine-binding domain (PTB) 0.000000609
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3TFC1
Sequence length 210
Comment (tr|A0A2I3TFC1|A0A2I3TFC1_PANTR) Amyloid beta precursor protein binding family B member 2 {ECO:0000313|Ensembl:ENSPTRP00000087901} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0003712 OC=Catarrhini; Hominidae; Pan.
Sequence
MAERKNAKALACSSLQERANVNLDVPLQVDFPTPKTELVQKFHVQYLGMLPVDKPVGMDI
LNSAIENLMTSSNKEDWLSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHT
FAFIMDTGNQRFECHVFWCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKVRPPPPPADS
VTRRVTTNVKRGVLSLIDTLKQKRPVTEMP
Download sequence
Identical sequences A0A2I3TFC1
ENSP00000423765 ENSP00000425802 ENSP00000439357 ENSP00000423765 ENSP00000425802 ENSP00000439357 gi|260593733|ref|NP_001159523.1| gi|260593735|ref|NP_001159524.1| gi|260593737|ref|NP_001159525.1| gi|260593740|ref|NP_001159526.1| NP_001159523.1.87134 NP_001159523.1.92137 NP_001159524.1.87134 NP_001159524.1.92137 NP_001159525.1.87134 NP_001159525.1.92137 NP_001159526.1.87134 NP_001159526.1.92137 XP_001145914.2.37143 XP_003310348.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]