SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I3TLK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I3TLK8
Domain Number 1 Region: 69-103
Classification Level Classification E-value
Superfamily LysM domain 0.0000876
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I3TLK8
Sequence length 306
Comment (tr|A0A2I3TLK8|A0A2I3TLK8_PANTR) LysM, putative peptidoglycan-binding, domain containing 3 {ECO:0000313|EMBL:JAA06487.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0009209 OC=Catarrhini; Hominidae; Pan.
Sequence
MAGRHQNRSFPLPGVQSSGQVHAFGNCSDTDILEEDAEVYELRSRGKEKVRRSTSRDRLD
DIIVLTKDIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTET
LCPPKGRQTSRHSSVQYSSEQQEILPANDSLAYSDSAGSFLKEVDRDIEQIVKCTDNKRE
NLNEVVSALTAQQIRFEPDNKNTQRKDPYYGADWGIGWWTAVVIMLIVGIITPVFYLLYY
EILAKVDVSHHSTVDSSHLHSKITPPSQQREMENGIVPTKGIHFSQQDDHKLYSQDSQSP
AAQQET
Download sequence
Identical sequences A0A2I3TLK8
ENSPTRP00000029213 9598.ENSPTRP00000029213 ENSPTRP00000029213 XP_003822823.1.60992 XP_016808498.1.37143 XP_517659.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]