SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I4C0N5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4C0N5
Domain Number 1 Region: 830-978
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-37
Family Regulator of G-protein signaling, RGS 0.0000764
Further Details:      
 
Domain Number 2 Region: 1163-1263
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-29
Family Ras-binding domain, RBD 0.0008
Further Details:      
 
Domain Number 3 Region: 309-430
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-20
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 
Domain Number 4 Region: 34-120
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-20
Family PDZ domain 0.0081
Further Details:      
 
Domain Number 5 Region: 1109-1177
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000413
Family Ras-binding domain, RBD 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I4C0N5
Sequence length 1670
Comment (tr|A0A2I4C0N5|A0A2I4C0N5_9TELE) regulator of G-protein signaling 12 isoform X1 {ECO:0000313|RefSeq:XP_013873558.1, ECO:0000313|RefSeq:XP_013873559.1, ECO:0000313|RefSeq:XP_013873560.1} KW=Complete proteome OX=52670 OS=Austrofundulus limnaeus. GN=rgs12 OC=Austrofundulus.
Sequence
MEKKRFPGTMSRHLDSLSKRRPCVGGGLNFPPPPPAPYGRIKAVEVARGRTGYGFTLTGQ
SPCVLSCILKGSPADYVGLRSGDYILSVNDINVSKASHEDVVKLIGRCSGVLKLVIAEAE
HRRRHHQRSTVSRHHSLSAVAAAAYLDSCSSEDELDGFYDSSVINNNNNSRSGARGGWCK
PKVDSKQLGINRAERVVAELQSGGIFNMIFENSSHSSSSSDKDRPGLSSSSKPRPVSDPE
FFPYRNPSRSQSNPNLLSEEEMAQVLNDDSVFLEPDVRHLHLHHQEEQDLDVEEGGDFVL
EPGEGILNVGMIVGYLGSIELASTGTNLESDSLQAIRGSMRRLRAEQKIHSLVLMKVMHD
SVRLCSDRGHVLATYPAEKLAFSACCPDDRRFFGLVTMQASDDYDDHHFSNGQDEEGGLR
TSCHVFIVDPELCQHQVHLGVARRFGFECTPDPDTGGCLEFPPSSQPLLQFVSVLYRDMG
DNIEGVRARAFHDPDNDAQQNHSTSSNSDSGIGNFLPEEKSNRVLLVDLGGPPSHNHTSG
TRHWDSPPSSQQAWSPTLGASAAAHPPPPPLPPPPPMLRNGHYLHDAHLADLPHPLPLAH
PDCPGRLSRGLHPHHYSSSGKLGGERRGGGAAGAEPQRWLPVHVLRDWRQQHHHSHFQGL
SSDQESYAESTDGWSSANCSTLPPPMNKIPADRYRAPLAPGDHLQKPAGSQPPPTHPHTH
RLTVQKDEWAKKLFGDRERTGARRSEKERKREGKVEGNLKEGEKKGGRFRGLTMGFPPLP
QRSSARRSFGRSKRLSMARSLDDLESAAVSDGELNSVELQGCSSDNSLNSNASLPSVQYH
QRHTERRVASWAVCFERLLQDPVGVRYFSEFLKKEFSEENILFWQACEFFSHVPENDNKQ
LSQRAREIYNSFLSSKATTPVNIDSQAQLADDILNAPKPGMFKEQQLQIFNLMKFDSYTR
FLKSRLYQECMLAEVEGRPLPDPYHIPSSPTSKHSTTGSDRSNLSTPKKEEKKNKSGRSL
NEDSRDDSADRKKGMFFSWSRNRSFGKGPKKRELADFNYNFSGTNGRRESQGSLSSGASL
ELGTSGSGKNEVDGRAAADRGGSSTPLRQCNISLPDGSCCSVPLRAGVSIRELLQGLCEK
LCINLAAIDLFLVGGEKPLVLDQDCMTLSSRDLRLEKRTLFRLDLVPINRSVGLKAKPTK
PVTEVLRPVVAKYGLHLADLVAHISGESEPLDLGLPISNLDGLRVVLDIEENIPGKDKQK
VAPSKSHLPASTSRNQSSTGEDRPSRKAGTAHPHGENGKAGPGLDKSGQPLSNHKAPGKR
KQKKINIDEAEEFFDLISKAQSNRADDQRGLLNKSDLQLPDFLRLSPAAGDPEPSRPAPH
SRRPANGSFPGSGRRGNQSHSHDRGGVANAHSLSASHQSQSLDSALGTESGGGSKPRAPP
LFSAGVSPVHPSRAAPHLQDSARGEPLQTPEEDTLSDLTLVGESDINSPSLHYVTPSALL
SKALPRPQQQAQDGPPGSGKDRIGCSGRGKGGSGFRMPNRRTTSSNPTPCSPPSPPPRPP
LRSRRKSKSPSSRSGRAAPKQALDLDKVGGASDPKAVRRRGPRDLQGLQFSELDRKWEGV
ALELQCRGSRMRSAVYQTSDLPTMVKVKKQLDQSYGKGQIDRSKLKATFV
Download sequence
Identical sequences A0A2I4C0N5
XP_013873558.1.33752 XP_013873559.1.33752 XP_013873560.1.33752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]