SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2I4C4R9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4C4R9
Domain Number 1 Region: 674-797
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.55e-38
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 
Domain Number 2 Region: 987-1085
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.43e-29
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 3 Region: 20-100
Classification Level Classification E-value
Superfamily PDZ domain-like 1.1e-19
Family PDZ domain 0.0075
Further Details:      
 
Domain Number 4 Region: 201-344
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000172
Family Phosphotyrosine-binding domain (PTB) 0.049
Further Details:      
 
Domain Number 5 Region: 933-1001
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000723
Family UBX domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I4C4R9
Sequence length 1418
Comment (tr|A0A2I4C4R9|A0A2I4C4R9_9TELE) regulator of G-protein signaling 12-like isoform X1 {ECO:0000313|RefSeq:XP_013874987.1} KW=Complete proteome OX=52670 OS=Austrofundulus limnaeus. GN=LOC106525338 OC=Austrofundulus.
Sequence
MRIQGQPEGARRRLDLNATAELRGVEIIRGRAGYGFTIMGQKPCLLSGIMEGSPAQLVGL
RQGDCIMAINGADVSTATHESVVQLVGSCTGPLRLVVLAERRVMGNPILNDAKFGFVQKS
NVFQKPSVLRTISDDSSNSSNSNHVAESKQRPVSEPDMSRWSQQWSTLAEQTKKEAPTVR
DTDSVFTDTEEVNPNWAILNMTLVVGYLSSTELILNPNDSVDDCLKAIRERIRQLGTEQN
THTLVMMKIMFDCVRLCDDAGAVLAAFPAENLVLGAVCAEDPRFFCLVTTAHIVNGRVPD
HGPLRASCHVFFIDPELGNHEDHKGIAGRFGFDCTLDPDAFGCLEFPQTPPDVLHFVTVL
YSDLGEAVERLRVKLDSEAQLQAKESDNTSKQGRASSNGDSGIGNASPPEERTERDFPPE
TRNHSGAHLPSCPWDYSPAKDITPINLFRDGQILNPENYASTHSLSESLPGPDSLTSFYG
GPPPRLEFRFKPPPPPLPLAKKTNFLADPLRSSQRWFSKPKWAKNLSSDSVPQEIPTKNW
SANSSATTNNLPPSDRYQSKEAMMPPREEWTKRFLEQRQKQRTDGSSKSGSKFWGVGVVR
ASKRRSVKRLSMARSLDDLESAASSDGALKWPSAAVIADYSGIQLQGCCSHSSLTSNGSL
PGAGSSRRDREQRVASWATCFERLLQDSVGVRYFTEFLKKEFSEENILFWQACEYFSHVP
ATDKKQLSQRAGEIYNSFLSSKATMPVNIDSQAQLADDVLTSPRPDMFKTQQLQIFNLMK
FDSYSRFLKSSLYQECLRAEVDGQPLPDPYQIPCSPAPSKHSASSDRSTLSTPKKEPRKQ
KSGKSPIEDGSESADKKRGIFFSWSRNRSFGKGPKKKDIGDINLDYYSSNGRRESQGSLS
SSTSLEIPISGSTAKMESDNRHSVGAWDRSPRHCSVLLPDGSCSTITLRPGAYIREVLQD
LCRNISVNIAAVDLFLVGGEKPLVLDQDCMTLCSRDLRLEKRTLFRLDLVPINRSVGLKA
KPTKPVTEVLRPVVAKYGLNLGDLVAKISGETEPLDLGAPISNLDGLRVVLERADPCSVK
EKSKSSSXKNHPPTRSYSAAGDERSTPKDFSVRASGPDSALPGEKRKQKKINIDEAEEFF
ELLSRAQSSRANDQRGLLSKEDLVLPDFLRLTPPTSSCSASAGLACSTPASAKQKGTPPR
GSLTXGLRSESLDSSLSSSANGHSAARRCLLPPPRHSTFGTHLSPIQRPSEPRPSLRTVE
EDAPADLTLVAEADINSPNSTLLPPSPSPXASFNSSLPEANFTPPPPCPQPQLAGGQGKS
TSEGRTETSPSIKAPADRSDATQPLLQDVMDVEGVHLEEGTLEPSQGEDSELSLSFQGYV
AELRQCQTKMRSAQMPQNGRNPAEAKDCQSDLYKATIV
Download sequence
Identical sequences A0A2I4C4R9
XP_013874987.1.33752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]