SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I4N8R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I4N8R2
Domain Number 1 Region: 259-416
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000287
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 
Domain Number 2 Region: 5-63
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000657
Family SinR domain-like 0.017
Further Details:      
 
Domain Number 3 Region: 143-222,258-298
Classification Level Classification E-value
Superfamily TPR-like 0.0000000114
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2I4N8R2
Sequence length 417
Comment (tr|A0A2I4N8R2|A0A2I4N8R2_CLOBO) Tetratricopeptide repeat family protein {ECO:0000313|EMBL:APQ73469.1} OX=1491 OS=Clostridium botulinum. GN=RSJ3_3464 OC=Clostridium.
Sequence
MEILSVGQKIKRARVYKGYTLKELCGDIISVSKMSCIENDKIKPDDEILKIISEELEIDI
KYLKAGVKEQLLDNIDKLKDNKNSSDYEKILEYNLKYAEEYKYYHIAFYIIHMLFNYYLE
NSEIEKLQLIISKYYDYWLKSGIDDNKIIYYMDIAKFFFETKEYIEAASYYRSIRKIAHE
KNNYILLSEATYDEAACYIKIKEFDKAYEIAVSLIDLIDFLDNNIKKAEVYKILAILSLR
LDRKKFENYEEKSYVLYGNDLIHKADATFKYATAMFDIGEKDKGISYINKALDLYPKNNT
RAFVSFMLDTMKVLLKNDVLYRAQEISDEILNYAIKINNIRFIEKAYYYKAIILEKQGSL
DTAEMYMNLSLDSILKFGTKQEIYERYMKMGNMYHKMNQVGESIKYFNLAIKLSKKL
Download sequence
Identical sequences A0A175MFC9 A0A2I4N8R2 A5HYU9
413999.CBO0405 gi|148378408|ref|YP_001252949.1| WP_011948173.1.101508 WP_011948173.1.11051 WP_011948173.1.11430 WP_011948173.1.18088 WP_011948173.1.21778 WP_011948173.1.2334 WP_011948173.1.25352 WP_011948173.1.26185 WP_011948173.1.49498 WP_011948173.1.49536 WP_011948173.1.49637 WP_011948173.1.52741 WP_011948173.1.57120 WP_011948173.1.64959 WP_011948173.1.68124 WP_011948173.1.73124 WP_011948173.1.74799 YP_001252949.1.75347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]