SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I7N7W3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I7N7W3
Domain Number 1 Region: 125-275
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 4.19e-43
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.00011
Further Details:      
 
Domain Number 2 Region: 9-103
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 1.22e-18
Family DHN aldolase/epimerase 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I7N7W3
Sequence length 283
Comment (tr|A0A2I7N7W3|A0A2I7N7W3_9NEIS) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase {ECO:0000313|EMBL:AUR52522.1} OX=2052837 OS=Neisseriaceae bacterium DSM 100970. GN=CUN60_09500 OC=Neisseriaceae; unclassified Neisseriaceae.
Sequence
MMMNNEQMYLNIDGITANALIGCYSYERGMLQPVEVSLKLYISKPDYADGIESTVDYSEV
CDYVKSVIAANHFHLVENLAKQLAHQLLLNYPLLNKVEITVSKSLVNGVKAKHISCHFTQ
KRKFKVALALGSNMNNPRQQLINAIELLGEFIDDIKIASFYRSKPQGYSEQEDFYNTCIS
GYTSYTPQELLINTKKVEKLLGKKEEFINGPRIIDIDIALYESKIYNNLFLAIPHPRMYE
RDFVITPLAEIEPDWLHPKLNISIKEIKNSLANSENFIIEQIS
Download sequence
Identical sequences A0A2I7N7W3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]