SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2J6U4I6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J6U4I6
Domain Number 1 Region: 9-269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-83
Family Protein kinases, catalytic subunit 0.00000344
Further Details:      
 
Weak hits

Sequence:  A0A2J6U4I6
Domain Number - Region: 517-578
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0262
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J6U4I6
Sequence length 674
Comment (tr|A0A2J6U4I6|A0A2J6U4I6_LACPN) Non-specific serine/threonine protein kinase {ECO:0000313|EMBL:PME03204.1} KW=Complete proteome OX=337330 OS=Lactobacillus plantarum subsp. plantarum. GN=S101520_00350 OC=Lactobacillus.
Sequence
MTPNYTLSGRYRIVRSLGEGGMANVYLAHDLILDRDVAVKLLRLDLRDDPKTIKRFQREA
LATTELVHPHIVSLYDIGEENGMQYLVMEYVKGMDLKNYIKENFPLPLQQVIDIMEQILS
AVATAHAHNIIHRDLKPQNILIDEQGNAKITDFGIAVALSEHTMTQTNTILGSVHYLSPE
QARGSMATKQSDIYSLGIILYEMLTGSVPFKGETAVSIALKHFQNAMPSVREFDADIPQA
LENVVLQATTKDPRERYATVEDMAADLLTVLASNRAGEKRFVPQDVGNDETKIMPSADIQ
AAIAANQDGKTQVVAHKSKQPTLQRPAETTESQTDADEEPLPTRSWSKRHPLRRRLLFWG
GIILLLVVAVIVGLELSRPQMTTVPKVTGLSQRAATKVLKKHHLTVGTVQHAKSNQVAKN
QVIKSTPSVKTRVQERARINLVISNGAKVMSFGNYVNDNYHDVRQTLKSAGFKVKETYST
SSVAAGQIISQDVVAGSRVMPTDTTVTFTVSAGSRYVELKDLTGESKSDILDYAEANDLN
VNFKQGYSSEQKAGYSYDQDPDGGGNVRTGSTITVTMSRGSDNNVTTPQNFYVKLTVPYK
ALSATTAQANDVKIYLYDDTHMIETVYRDIAIMRSTKISLPFQLTGNTKGHYRIVRNGVT
IMEKKNITSKSATK
Download sequence
Identical sequences A0A291MJU5 A0A2J6U4I6 F9UNZ3
WP_011101478.1.20190 WP_011101478.1.27617 WP_011101478.1.44182 WP_011101478.1.57 WP_011101478.1.6273 WP_011101478.1.73499 YP_004889446.1.96219 gi|380032455|ref|YP_004889446.1| 220668.lp_1619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]