SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2J7QP75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J7QP75
Domain Number 1 Region: 775-897
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.4e-39
Family Regulator of G-protein signaling, RGS 0.0000622
Further Details:      
 
Domain Number 2 Region: 1077-1169
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-23
Family Ras-binding domain, RBD 0.0027
Further Details:      
 
Domain Number 3 Region: 9-93
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-21
Family PDZ domain 0.011
Further Details:      
 
Domain Number 4 Region: 1021-1089
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000269
Family Ras-binding domain, RBD 0.025
Further Details:      
 
Domain Number 5 Region: 204-317
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000615
Family Phosphotyrosine-binding domain (PTB) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J7QP75
Sequence length 1552
Comment (tr|A0A2J7QP75|A0A2J7QP75_9NEOP) Uncharacterized protein {ECO:0000313|EMBL:PNF30397.1} KW=Complete proteome OX=105785 OS=Cryptotermes secundus. GN=B7P43_G12863 OC=Termitoidae; Kalotermitidae; Cryptotermitinae; Cryptotermes.
Sequence
MHPIRRRKKRPNYGVRTVEVSRGKNGFGFTISGQQPCILSCIVAGSPAEKAGLRPGDYLV
AVNGQSVSKVPHDDVVRLIGCSSGILKLQIAENYYSDSSDEDAIIPARPKPKYMHKPRNG
GHNQRTTASSQQSRGAKIVRDLRTGAMYEQQVEPSAMLQSPGKSDPPLSQQWEPPVPLPL
PRPRFYPHPQTEESCEQDRDKVEFRALVGYLGTIEMPKKLQPGSRLQVVRSCIKRLRTEK
RAHTLVLMSIHTHSLTLTNCHKVTLAEYPSDRVTFCGTSSDEERRFFGIITTAVRSVEDE
NDGRELVHSSSCHVFAIELRLHGIHGEHAGKADAFSLHCTVDAATGFCTEFPSSSDPIIS
AIKVLCSSQETGTAGNPYVEEPLVANSPQPSNASSITTTASSNSDSGIGFRDDCGNQSDR
ILVVDVQNQRLHIQQMVNSNCEVQQGNISGVNQPKSCMYGLTGSANSRLVKRPDDRLTVR
VMPDPVMNLSGTLAVSSHSRSPLSSSSSEGENHEQKSNPCIEIYSEQVDVPVYDFSSYCG
ETALSKNMATRSNDDMSVSSGTNKSQDQLNLQYKHNMYKNFMTNKTVSQCFHTNIKEKSV
NDANYNFPRFPLIVKSARSVGAMNIGSVQSHDAVLSCKLSPKVFGTPLRPMTHSLEDLKV
TEVPNDEKDPLAASLSLSSRGQHWGSLQDLRSFVVNCFEASPPPKDMNRPQLKKWGVATF
TATKTFVRATTGPRAGKRISRNLQRSSSDEGVFSKHEGHDPGVELLQEDERERGVASWAT
SFEKLLGDPAGLHTFAEFLKKEFSHENIYFWVACEKYRSLSSPTERTISARDIFERHLCL
GALEPVNVDSHARQATQDGLTDAASTLFLQAQKQIFNLMKFDSYPRFLKSDLYKECLVRE
LSGQELPFPGGDNLDTGLQLHGTGSYPSHSKLKKSRSDAEDRHRKSLLPWHRKNRSKSKD
RGESEYNKLRMLQQKHDTEDTVSVRSDVTSSRSSLASWDLALRGSFSRQSVTSGEGESCC
TLCRVILPDGATTVVQTRSSESVRDLVLRLLDKRGLHYSAFEVFDGTSVKPLSLDEDSTI
LAGKEVHVEQRAVFRLDLPNRKTVGVKAKIDKSLGEILRPILHKYGYKLELVTLCLMSEN
EVVEISAPVISVDSQRLQVLTRSAEAWKNEVAHTVASQHRLKVAGPTLDEITNRVFEELL
QGKATETTHTASDQGSIRSEDWGSEHSSGIFGRFLRRDSALLDKVRESRVKGKKAFGISK
HVGDESEAKVVPTSHPKPPLITKWKVGVKLQGRSESDELYEGLKRAQRSRLEDQRGTEIN
FELPDFLKDKENAPQTGKKFRKLRRGEENTSKVCEPSELHPESQHASNSQERLPAGTSGT
RCGYHTDRTTPGALVTRLLDQSFVAEGVIPSPHQAEEYFLGHRPDPNKLDKTHHGDISGA
GSSLENTLVELNPLEATLTCVDSRDEVNQGLNRLHQHSEPPPLPPKPKHLPLKTSMWESS
SNASGSTNPSTFRAPGDSANSRFLRPTEVKRDVRVCRSRRTVYLDQPSSSFV
Download sequence
Identical sequences A0A2J7QP75

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]