SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2J8M2F1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8M2F1
Domain Number 1 Region: 1-68
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.6e-20
Family GABA-aminotransferase-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8M2F1
Sequence length 70
Comment (tr|A0A2J8M2F1|A0A2J8M2F1_PANTR) ETNPPL isoform 8 {ECO:0000313|EMBL:PNI53705.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0024105 OC=Catarrhini; Hominidae; Pan.
Sequence
MGHCHPGVVKAALKQMELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDL
ALRLARQFRG
Download sequence
Identical sequences A0A2J8M2F1 D6RFL9
ENSP00000426525 ENSP00000426525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]