SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2J8MFP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8MFP1
Domain Number 1 Region: 46-274
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.15e-67
Family Carbonic anhydrase 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8MFP1
Sequence length 276
Comment (tr|A0A2J8MFP1|A0A2J8MFP1_PANTR) CA10 isoform 3 {ECO:0000313|EMBL:PNI58320.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0020983 OC=Catarrhini; Hominidae; Pan.
Sequence
MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLC
SVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGG
PMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLV
VVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMT
IPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPS
Download sequence
Identical sequences A0A2J8MFP1 A0A2J8W881 I3L375
ENSP00000460238 ENSP00000460238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]