SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2J8N6C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8N6C9
Domain Number 1 Region: 1185-1316,1379-1445
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.87e-38
Family Hemopexin-like domain 0.00092
Further Details:      
 
Domain Number 2 Region: 68-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000262
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000127
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8N6C9
Sequence length 1445
Comment (tr|A0A2J8N6C9|A0A2J8N6C9_PANTR) PRG4 isoform 3 {ECO:0000313|EMBL:PNI67319.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0013515 OC=Catarrhini; Hominidae; Pan.
Sequence
MAWKTLPIYLLLLLSVFVIQQVSSQDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDF
KRVCTAELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAP
PPSGASQTIKSTTKRSPKPPNKKKTKKVIESEEITEEHSVSENQESSSSSSSSSSSSTIR
KIKSSKNSAANRELQKKLKVKDNKKNRTKKKTTPKPLVVDEAGSGLDNGDFKVTTPDTST
TQHNKVTTSPKITTAKPINPRPSLPPNSDTSKETSLTVNKETTVETKETTTTNKQTSTDG
KEKTTSAKETQSIEKTSAKDLAPTSKVLAKPTPKPETTTKGPALTTPKEPTPTTPKEPAS
TTPKEPTATTIKSAPTTPKEPAPTTPKEPAPTTPKEPAPTTTKSLHPPLPRSLHPPLPRS
LHPPPPRSLHPPLPRSLHPPPPSLHPPLPRSLHPPPQEPAPTPPPPTSPTTPKKPAPTTP
KEPAPTTPKEPAPTTTKSAPTTTKEPAPTTTKSAPTTPKEPAPTAPKKPAPTTPKEPAPT
TPKEPAPTTTKSAPTTPKEPSPTTTKEPAPTTPKEPAPTTPKKPAPTTPKETAPTTPKEP
APTTTKKPAPTTPKEPAPTTPKETAPTTPEKLTPTTPEELAPTTPEEPAPTTPEEPAPTT
PEEPAPTTLEEPTPTTPEEPAPTTPKTAAPNTPKEPAPTTPKEPAPTTPKETAPTTPKGT
APTTLKEPAPTTPKKPAPKELAPTTTKEPTSTTSDKPAPTTPKETAPTTPEETAPTTPEE
TAPTTPKGTAPTTPKGTAPTTPKGTAPTTPKETASTTPKGTAPTTLKEPAPTTPKKPAPK
ELAPTTTKKPTSTTSDKPAPTIPKETAPTIPKEPAPTTPKKPAPTTPETPPPTTSEVSTP
TTTKEPTTIHKSPDESTPELSAEPTPKALENSPKEPGVPTTKTPAATKPEMTTTAKDKTT
ERDLRTTPETTTAAPKMTKETATTTEKTTESKITTTTTQVTSTTTQDTTPFKITTLKTTT
LAPKVTTTTKKTITTTEIMNKPEETAKPKDRATNSKVTTPKPQKPTKAPKKPTSTKKPKT
MPRVRKPKTTPTPRKMTSTMPELNPTSRVAEAMLQTTTRPNQTPNSKLVEVNPKSEDAGG
AEGETLHMLLRPHVFMPEVTPDMDYLPRVPNQGIIINPMLFDETNICNGKPVDGLTTLRN
GTLVAFRGHYFWMLSPFSPPSPARRITEVWGIPSPIDTVFTRCNCEGKTFFFKDSQYWRF
TNDIKDAGYPKPIFKGFGGLTGQIVAALSTAKYKNWPESVYFFKRGGSIQQYIYKQEPVQ
KCPGRRPALNYPVYGETTQVRRRRFERAIGPSQTHTIRIHYSPARLAYQDKGVLHNEVKV
SILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKV
WYNCP
Download sequence
Identical sequences A0A2J8N6C9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]