SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2J8NTN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8NTN7
Domain Number 1 Region: 22-117
Classification Level Classification E-value
Superfamily Immunoglobulin 1.38e-22
Family C1 set domains (antibody constant domain-like) 0.00000653
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8NTN7
Sequence length 119
Comment (tr|A0A2J8NTN7|A0A2J8NTN7_PANTR) B2M isoform 2 {ECO:0000313|EMBL:PNI75123.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0008732 OC=Catarrhini; Hominidae; Pan.
Sequence
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLL
KNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Download sequence
Identical sequences A0A2J8NTN7 P16213 P61769 P61770 P61771
ENSP00000452780 ENSP00000453191 ENSP00000453350 ENSP00000481426 ENSP00000452780 ENSP00000453191 ENSP00000453350 ENSPTRP00000011997 ENSPTRP00000011997 gi|4757826|ref|NP_004039.1| NP_001009066.1.37143 NP_004039.1.87134 NP_004039.1.92137 WP_073668312.1.37512 XP_004056148.1.27298 XP_008962051.1.60992 XP_019295877.1.44245 3jts_B 3jts_E 3jts_H 4wwk_D 5bxf_B 5bxf_D 5j1a_B 5whk_B 6at5_B 9598.ENSPTRP00000011997 9606.ENSP00000340858 NYSGRC-IgSF-B2MG_HUMAN ENSGGOP00000026553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]