SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2J8R349 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8R349
Domain Number 1 Region: 8-178
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.52e-23
Family AAT-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8R349
Sequence length 180
Comment (tr|A0A2J8R349|A0A2J8R349_PONAB) AADAT isoform 1 {ECO:0000313|EMBL:PNJ02938.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0054434 OC=Catarrhini; Hominidae; Pongo.
Sequence
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT
IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG
LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP
Download sequence
Identical sequences A0A2J8R349 D6RC56
ENSP00000423843 ENSP00000423843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]